PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo0G0050400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 292aa    MW: 32945.9 Da    PI: 9.5085
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo0G0050400genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.25.9e-16125170147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
   Spipo0G0050400 125 RGHWRPAEDTKLRELVALYGPQNWNLIAEKLA-GRSGKSCRLRWFNQ 170
                      899*****************************.***********996 PP

2Myb_DNA-binding55.91e-17178220246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       ++T+eE+e+l  a++ +G++ W++Iar ++ gRt++ +k++w+ 
   Spipo0G0050400 178 RAFTKEEEERLMAAHRAYGNK-WALIARLFP-GRTDNAVKNHWHV 220
                      689******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.687120171IPR017930Myb domain
SMARTSM007173.0E-14124173IPR001005SANT/Myb domain
SuperFamilySSF466895.24E-28125218IPR009057Homeodomain-like
PfamPF002491.1E-15125170IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-25126178IPR009057Homeodomain-like
CDDcd001674.95E-13128169No hitNo description
PROSITE profilePS5129425.69172226IPR017930Myb domain
SMARTSM007172.5E-14176224IPR001005SANT/Myb domain
PfamPF002491.0E-14178219IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.3E-21179225IPR009057Homeodomain-like
CDDcd001672.20E-11179219No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MSPHQFHEDQ GRGTEANIYV ARSCSPPSSC LPEPVFNQMA PFCHNPYSSP GKEEDGCWNN  60
QERAFWTLCG ENRYSHLSPS QKHDSEAGPG GAFSERTIMD FEPSAVDADG RPSDKGGNYL  120
KLSGRGHWRP AEDTKLRELV ALYGPQNWNL IAEKLAGRSG KSCRLRWFNQ LDPRIEKRAF  180
TKEEEERLMA AHRAYGNKWA LIARLFPGRT DNAVKNHWHV IMARKYREQS SAYRRRKLSQ  240
QQHAHTRLKE PSRAACFPPP TTSTGGAYTA FQPQLLFRFY GVGSVPGLGH N*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-321252267108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257780.14e-77PREDICTED: uncharacterized protein LOC104597747
TrEMBLB9S8Y57e-76B9S8Y5_RICCO; R2r3-myb transcription factor, putative
STRINGGLYMA01G05980.24e-75(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.14e-73myb domain protein 105